The optical system of the SpectraMax 340PC384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for. Light Source: Xenon flash lamp. The SpectraMax reader’s optical system mimics a dual-beam spectrophotometer. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. Our absorbance plate readers feature our PathCheck Sensor technology and. Wavelength range: Excitation: 250-850 nm, Emission: 360-850 nm. Spectral Range. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Narrow bandwidths deliver increased measurement accuracy and linearity over the widest range of assays, including. Detection modalities include absorbance (UV-Vis Abs) and fluorescence intensity (FI). 7. The SpectraMax Plus 384 reader is equipped with an innovation patented by Molecular Devices, the PathCheck® sensor, which measures the depth of a sample in a microplate by optical path length. Mode 96-well 384-well 1536-well Optimizedforspeed 12seconds 25seconds 50seconds Optimizedforperformance 20seconds 40seconds 80seconds Table1-1:PlateReadTimesforOn-the-FlyDetection(± 5. Validate the optical performance of your absorbance . Molecular Devices SpectraMax 384 Plus Microplate Reader. Simplified microplate washing from single-tube dispensing to washing full 96- and 384-well plates. The SpectraMax L reader is upgradeable to dual-channel configurations for a 2-fold. Users can password-protect data, choose from nine different curve-fitting routines and use default data reduction, or set up custom formulas for analysis. By measuring optical pathlength, it eliminates the last major distinction between microplate readers and spectrophotometers. 더 많은. 100 fmol 1536-well (8 µL) 0. 9 in. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. The plate reader optics are tunable for absorbance, fluorescence intensity, fluorescence polarization, and time resolved fluorescence assays (TRF). o SpectraMax M2 - Well Scan read mode - single well read coordinate problem fixed. Molecular Devices SpectraMax i3 Multi-Mode Microplate Reader Pred i3x - AV $14,995. Page 14: Component Description† Bottom mounting for SpectraMax Paradigm Readers only. 4. Molecular Devices’ SpectraMax® Plus 384 Microplate Reader provides fast and reliable full spectral range detection for cuvettes, 96-well and 384-well microplates. 4 µL DNA standards. microplates or in a cuvette at a selected. Essentially, all UV/VIS spectrophotometric assays that are read in a conventional spectrophotometer or micro plate reader can be read in the SpectraMax Plus: DNA/RNA/protein quantitation and purity. SpectraMax190reads96-wellplates. . SpectraMax L Microplate Reader is a sensitive luminometer with programmable injector options that measures flash and glow luminescence assays, including dual luciferase reporter gene, G protein-coupled receptor (GPCR) in 96- and 384-well plates. 384-wells, the SpectraMax iD3 reader is the complete solution for all your research needs. PathCheck Sensor. Note: for SpectraMax microplate readers without a cuvette port, the water constant is automatically used in PathCheck calculations, and no Water Constant option appears in the Instrument Settings. The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentrations. No accessories are needed and SoftMax® Pro Software. 1. These upright laboratory refrigerators will fulfill all general-purpose applications, with adequate space for ventilation. Transcreener® HTS is a universal, high throughput biochemical assay platform based on the detection of nucleotides, which are formed by thousands of cellular enzymes—many of which catalyze the covalent regulatory. SPECTRAmax® PLUS384 is the only spectrophotometer with a built-in cuvette port and microplate drawer. DNA provides the same sensitivity as a spectrophotometer. Page 6 SpectraMax Plus384, 190, 340PC384, and VersaMax Installation Guide Connecting Instrument Cables The power cord and USB cable connect to the ports on the rear of the instrument. AlphaScreen and AlphaLisa detection using a 680 nm excitation laser diode and a 570/100 nm emission filter. A & K Biosource are the pros on this, but these plate readers are quite expensive to repair/calibrate. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. Keywords: spectramax m2 systems, spectramax m2e systems, spectramax m2/m2e readers, pathcheck sensor, spectratest abs1 absorbance, stakmax stacker Created Date: 5/20/2019 9:24:38 AM SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. SpectraMax i3x Multi-Mode Microplate Reader. Page 78 SpectraMax iD3 Multi-Mode Microplate Reader User Guide 4. flat meniscus), but is approx 15 mL. 00 USDThe SpectraMax® M2 and M2e Systems from Molecular Devices are multi-detection microplate readers with dual-. Clearance . Molecular Devices, LLC. This white, polystyrene ProxiPlate™ has shallow wells allowing for lower volumes to be used in assays. In addition, the iD5 reader measures TRF and FP and can be expanded to include TR-FRET, HTRF®, BRET, dual luciferase reporter assays with injectors, and western blot detection. For wavelengths in the UV range above 220 nm,. The SpectraMax® Glo Steady-Luc™ Reporter Assay Kit provides a highly sensitive assay for the quan-titation of firefly luciferase expression in mammalian cells. Enables data acquisition in endpoint, kinetic, and spectral scan modes at wavelengths across the UV-visible wavelength range, with the only temperature-independent method of pathlength correction. Top detection is available for fluorescence detection on the SpectraMax M2, while top and bottom reads are possible on the SpectraMax M2e. Products : SpectraMax Plus 384 reader, SpectraMax 190 reader, SpectraMax 340PC 384 (Obsolete), SpectraMax 250 (Obsolete), SpectraMax 340 (Obsolete), VersaMax reader How does stray light affect my OD reading? The basic problem caused by stray light (light you don't want, getting into the read) is a falsely low OD seen. 313 reference gain check fail. Both the SpectraMax M5 and the Gemini EM are monochromator-based, microplate readers. Molecular Devices SpectraMax 384 Plus Microplate Reader Specifications. Use preconfigured wash, soak, and aspiration protocols or create your own multi-step protocol using the simple touchscreen interface. TheSpectraMax®Plus384addstheabilitytoreadcuvettes. The instrument reads any standard cuvette, microcuvette, test tube or 96- and 384-well standard or UV transparent microplate over a full 190 to 1000 nm. One plate carrier adapter is provided with the instrument. The SpectraMax Vertical 1000 is available for purchase online and comes with a five-year warranty. Enables data acquisition in endpoint, kinetic, and spectral scan modes at wavelengths across the UV-visible wavelength range, with the only temperature-independent method of pathlength correction. 0200-6262. 020 fmol 0. Below is the list of Molecular Devices microplate readers and liquid handling instruments that are of out-of-production and are now considered obsolete. If desired, a high-range standard curve may be prepared from 1 ng/mL to 1 μg/mL, or a low-range standard curve may be prepared from 25 pg/mL to 25 ng/mL. The SpectraMax® and VersaMax™ require proper ventilation to keep their internal components cool. Fixed a problem where Column Priority rather than AutoRead was available in the SpectraMax 384 instrument setup. Molecular Devices SpectraMax Plus 384. TheSpectraMax®Plus384addstheabilitytoread cuvettes. Robust. Regularly used for NADPH ATPase assays, and BCA assays. Capture flash assays with ease Expand your lab’s capabilities to include flash applications such as dual luciferase and ATP assays with the SpectraMax iD3 injector system with SmartInject™ Technology ensuring equal mixingThe SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. 306 plate air cal fail,low light. Detection modalities are shown in Table 1-1. The SpectraTest® Validation Plates are valuable tools for verifying that absorbance-, fluorescence-, and luminescence-capable microplate readers are operating correctly for GMP and GLP laboratories. SpectraMax Microplate Readers. Sold as-is. Set up SoftMax Pro Software to use PathCheck as detailed above. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a variety of assays. For very concentrated samples, use a minimumThe ProcartaPlex 384-well format was specifically developed to increase sample throughput while maintaining the robustness of a 96-well assay. Page 10 Cuvette Chamber The cuvette chamber on the SpectraMax Plus 384 is located at the right front of the instrument. Customize data collection and analysis. 1) All parts of the SPECTRAmax 340PC 384 Microplate Spectrophotometer are warranted for a period of one (1) year from the original date of delivery. To prevent such interference, select the Interlaced Reading option to read every other well in a checkerboard pattern in the first run and then read the previously omitted wells in a second run. SpectraMax ABS Plus SpectraTest ABS2 v1. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. Biocompare is the leading resource for up-to. SpectraMax iD3 reader with touchscreen and inserted USB flash drive. Each SpectraMax® 340 PC 384 Microplate Reader has an. The narrow bandwidths used by the model increase measurement accuracy and linearity over a wide range. Monochromator wavelength selection saves you the time and trouble of ever having to. SpectraMax i3x Injector Cartridge with SmartInject® Technology. Chapter 1: General Information. The AquaMax® Microplate Washer is a fully self-contained system, configurable for both 96- and 384-well microplates. ester flash assays, in both 96- and 384-well plates. The SPECTRAmax™ PLUS microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentrations. 6 (H) x 22. With optimized reagents and the industry-leading data acquisition and analysis tool SoftMax® Pro 7 Software, the SpectraMax iD3 allows you to customize your workflow to. Labsystems Nepheloskan Ascent Microplate Reader. Shaker time 0 to 999 seconds Temperature control Ambient. , FI 45 sec. View the Molecular Devices website. This UV-visible absorbance microplate reader provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. Abs 49 sec. Typically the system can detect absorbance, luminescence, fluorescence, and even make more specialized fluorescence measurements like time-resolved fluorescence (TRF) and fluorescence polarization (FP). Compare. Microplate spectrophotometers, also called microplate readers, allow researchers to analyze multiple samples in parallel using 6- to 1536-well formats, as opposed to single sample measurements. For more sample throughput, the system canTo provide access to disconnect power from the instrument, maintain a 20 cm to 30 cm (7. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. Item SpectraMax 340PC 384 Tunable Spectrophotometer with SoftMax Pro Software; Company Molecular Devices LLC; This product is no longer available on Biocompare. In these readers, RLUs are proportional to counts/sec which doesn't change with. Features. ) 8. Or scan up to 384 wells at any time to. Monochromator, tunable 1. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. Temperature control and shaking included as standard. Corning® EcoChoice™ products are produced, packaged, and/or distributed in an environmentally friendly manner following United States Government Federal Trade Commission (FTC) Guidelines Learn More. Also for: Spectramax plus. used. With optimized reagents and the industry-leading data acquisition and analysis tool, SoftMax Pro® 7 Software, the SpectraMax® iD3 allows users to customize workflow to perfectly. The SpectraMax® iD5 Multi-Mode Microplate Reader is the complete laboratory solution to help you increase your research capabilities and comes with built-in absorbance, fluorescence, luminescence, time-resolved fluorescence (TRF), and tunable fluorescence polarization (FP) read modes. Learn how to operate the VersaMax, SpectraMax 340PC384 and SpectraMax 190 Plus384 microplate readers, which offer fast and accurate absorbance measurements for a. SpectraMax and VersaMax Plate Readers Operator’s Manual — 0112-0126 Rev A SpectraMax Plus384 SpectraMax 190 SpectraMax 340PC384 VersaMax Microplate Spectrophotometer Operator's Manual Molecular Devices Corporation 1311 Orleans Drive Sunnyvale, California 94089 Part # 0112-0126 Rev A. The SpectraMax i3x reader measures spectral-based absorbance, fluorescence, and luminescence with the added functionality of modular upgrades for western blot, imaging, and fast kinetics with injectors. 0. The SpectraMax 384 Plus lets you get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. SpectraMax iD5. Hybrid optical system on the SpectraMax iD5 reader. Biocompare is the leading. 314 low lamp level warning. Explore how the SpectraMax i3 Multi-Mode Platform provides an unlimited breadth of application possibilities, and how it can evolve with your future needs. The SpectraMax® Gemini™ EM Microplate Spectrofluorometer from Molecular Devices® provides a flexible environment. spr SpectraMax iD5 SpectraTest ABS2 v1. Now you can run both standard spectrophotometer and microplate reader applications on the same instrument. 5 mP 6 mP * For properly functioning, operated, and maintained equipment. Also see:. The SpectraMax® absorbance spectrophotometers and plate readers provide the versatility and convenience for a wide range of assays such as ELISAs, nucleic acid and protein quantitation, and microbial growth. Double-click the unknown device with the yellow warning icon. Charge heterogeneity with fast and simple CZE or with hi-res cIEF. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. Temperature control. This revolution in modularity makes no compromise detection the norm. The SpectraMax® iD3 and iD5 Multi-Mode Microplate Readers measure absorbance, fluorescence, and luminescence. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. Tailored to your different needs, these kits are configured and optimized for Molecular Devices SpectraMax® microplate readers with preconfigured protocols provid- The SpectraMax® iD3 Multi Mode Microplate . An ATP standard curve spanning five decades was run using the ATPlite 1step Luminescence Assay System (PerkinElmer) on the SpectraMax iD3 reader. Sold as-is. Regularly used for NADPH ATPase assays, and BCA assays. 96, 384 wells Light source Xenon flash lamp (1 joule/flash) Detector Photomultiplier tube (PMT) Read time** 96 wells: 384 wells: Abs 18 sec. 314 low lamp level warning. Shaking capabilities. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a variety of assays. Contains one microplate adapter, five 24-well low volume slides, five 64-well low volume bottom slides, and five of each cover slide (2 µL and 4 µL) 0200-6267. Multichannel optical design. 5065390D 3 Contents SafetyInformation 4 Warnings,Cautions,Notes,andTips 4 Chapter1:Introduction 7 ComputerIntegration 8 PlateControls 9 CuvetteChamber 10 Multimode Reader Comparison Chart. SpectraMax i3x. Related Products: SpectraMax 384 Plus UV/Vis Microplate Reader, Molecular Devices SpectraMax M2e Microplate Readers, Molecular Devices SpectraMax M5 Multi-Mode Microplate Reader,. Such cross talk can occur through the wall of a white 384 well microplate. Results were presented as mean ± standard deviation. Title: SpectraMax i Series Multi-Mode Microplate Readers | Molecular Devices Author: Molecular Devices Subject: SpectraMax i Series offer the ideal solution for any application whether you are looking for an intuitive, easy-to-use reader, multi-user lab, or an upgradeable system that can adapt to support your lab s new projects. With the SpectraMax® MiniMax™ 300 Imaging Cytometer, industry-leading SoftMax® Pro Software, and user. SpectraMax® iD3 and iD5 Multi-Mode Microplate Readers can measure absorbance, fluorescence and luminescence. SpectraMax® Absorbance Microplate Readers can run both cuvette-based and microplate reader applications on the same instrument. Perform the following steps to install the drivers: Start > Control Panel > System. The SpectraMax M2e are multidetection microplate readers with dual-monochromators, dual-mode cuvette ports, and top- and bottom-reading capability. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). For nearly 30 years, Molecular Devices has provided scientists with . The PA 800 Plus system is a robust analytical, kit-based platform that can help you with: Purity/Heterogeneity with gold standard CE-SDS in minutes. spr * SpectraMax i3(x) SpectraTest ABS2 v1. Experienced in operating and performing maintenance on numerous laboratory instrumentation from various large and small manufacturers including Spectramax 384 and i3 with Softmax software. Standard features include UV-visible absorbance in tunable 1,0 nm increments up to 4,0 nm, and fluorescence intensity with spectral scanning across the wavelength range in 1 nm increments and up to four wavelength pairs per protocol. 5 pg/µL to 200 ng/µL. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. 2 5. ester flash assays, in both 96- and 384-well plates. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a variety of assays. The narrow bandwidths used by the model increase measurement accuracy and linearity over a wide. SpectraMax iD3 reader is built on the same foundation that has made our entire SpectraMax microplate reader product line among the most trusted in the industry. 9. However, for greater flexibility, some instruments can accommodate 6- to 1536-well plate formats. and detection of plate formats from 6- to 384-wells, the SpectraMax iD5 reader is the complete solution for all your research needs. SpectraMax iD3 reader is built on the same foundation that has made our entire SpectraMax microplate reader product line among the most trusted in the industry. The reader is ideal for measuring flash and glow assays, including dual luciferase reporter gene, G protein-coupled receptor (GPCR) via aequorin, bioluminescence resonance energy transfer (BRET), and acridinium ester flash assays, in both 96- and 384-well plates. For 40 years, we have partnered with scientists to help them achieve landmark discoveries. When reading optical density at wavelengths below 340 nm, special UV-transparent, disposable or quartz microplates allowing transmission of the deep UV spectra must be used. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. The SpectraMax M2 and M2e systems provide the multi detection microplate readers with dualmonochromators, dual-mode cuvette ports, with top & bottom reading. 25 µL/well in a 384-well plate, using AlphaScreen Phosphotyrosine (PT66) Assay Kit 0200-7017. The SpectraMax M5e Micoplate Reader is the standard for UV/Visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes, 96-well and 384-well microplates. All SpectraMax® M series readers accept cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well microplates. SpectraDrop High-Throughput Screening (HTS) Kit. Wavelength Range. 1. Features demonstrated by the model include temperature control, a robot-compatible interface and data analysis software. Normally this fluorometric assay is performed in 96-well microplates. 96 , 384 , and 1536 well microplates Note: Detection Cartridges and PC not included. Total volume (except deep. 96-well Half Area 384- Low Volume 1536- Microplate Material 96-well Stripwell 96-well well 384-well well Clear polystyrene n n n n Solid black or white polystyrene n n n n n n Clear bottom black or white polystyrene n n n n n Polypropylene n n n Solid black or white polypropylene n n*SpectraMax Paradigm Multi-Mode Detection Platform User Guide Loading and Unloading Microplates To load or unload a microplate: 1. SpectraMax340PC384reads96-wellplatesand384-wellplates. Customize data collection and analysis. TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. used. Application note showing how SpectraMax® i3x and SpectraMax®iD5 Multi-Mode Microplate Readers are used to performGq-coupled receptor assays using HTRF technology. 8 in. In addition, the iD5 reader measures TRF and FP and can be expanded to include TR-FRET, HTRF®, BRET, dual luciferase reporter assays with injectors, and western blot detection. Learn more about its features, specifications, and applications in this user. The SpectraMax® iD3 and iD5 Multi-Mode Microplate Readers measure absorbance, fluorescence, and luminescence. Here, the CVs for each plate were less than 3, and the difference between mean onset time for the plates run on the two readers was only 7%. Detection of species collected on membrane plates is also possible. In luminescence mode, if you are specifying a wavelength for the read, you can select an emission bandwidth of either 15 nm or 25 nm. Compact design. Light Source: Xenon flash. 8 (W) x 15 (D)SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. 3) This warranty covers the SPECTRAmax PLUS 384The SpectraMax 384 Plus UV/Vis Microplate Reader is manufactured by Molecular Devices. The optical system of SpectraMax Plus384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for absorbance detection in the UV-visible wavelength range (190 nm - 1000 nm). The plate reader optics are. 5 pM 384-well (50 µL) 6 pM 10 pM 1536-well (8 µL) 19 pM 25 pM 0200-7015 (LUM 384) Optimized Guaranteed* 96-well (200 µL) 1. Page 19: Plate Adapter SpectraMax M2 and M2e Microplate Reader User Guide Plate Adapter Before you read standard 96-well or 384-well plates from the top, you must insert the plate adapter in the plate drawer. Time Resolved Fluorescence. Beer-Lambert Law states that. The Molecular Devices SpectraMax M3 Multi-Mode Microplate Reader is a dual-monochromator, multi-detection microplate reader with full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. where. It may be named "Pothos". The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). 滤光片型光吸收微孔板读板机（酶标仪），简单易用，性价比高，检测结果精确. 3) This warranty covers the SPECTRAmax PLUS 384MOLECULAR DEVICES SPECTRA max PLUS 384 Microplate Reader from Bid On Equipment. Figure 1. 8 (W) x 15 (D)This SpectraMax Plus 384 Spectrophotometer has been sold, but you can view our other spectrophotometers currently available for purchase here: Plus384, 190, 340PC384, and VersaMax Installation Guide Author: Molecular Devices Subject: Installation Guide Keywords: SpectraMax Versa and others Detection Platform Created Date: 5/17/2023 2:14:27 PMOn SpectraMax L, 1 RLU = 1 count per second for photon counting mode only. Reads from 190 to 1000 nm range across various vessels. The optical performance is comparable to a top-of-the-line dedicatedUnparalleled performance on a personalized platform. 2 SpectraMax MiniMax300ImagingCytometer(cytometer) 3. 과 같은 Parameter를 검사하여 평가할 수 있습니다. Use any standard cuvette, 12 x 75 mm test tube, 96- or 384-well. Key features 4 wells: 76 seconds Luminescence Specifications Dynamic Range < 6 decades Sensitivity 10 amol ATP General Specifications. Read one sample or up to 384 in a single plate. spr SpectraMax iD3 SpectraTest ABS2 v1. The SpectraMax® M3 Microplate Reader is the standard for UV/visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well microplates. SpectraMaxi3xMulti-ModeDetectionPlatformUserGuide 26 5039228DOther things to consider include plate format – 96-well and 384-well plates are the norm but higher and lower capacity plate sizes are also available, speed and throughput needed, type of software, and whether or not multiple plates or wells can be read simultaneously. Published Dec 16, 2020 | Updated Dec 16, 2020. Select ‘Water Constant’ in the Instrument Settings dialog box (Figure 3). Products : SpectraMax 340PC 384 (Obsolete), SpectraMax Plus 384 reader. On LabX buyers can find a variety of SpectraMAX models for sale: 190, 384, 340 and the SpectraMAX M series. The optical performance is comparable to a top-of-the-line dedicated Which SpectraMax M Series reader do you need? SpectraMax M Series Multi-Mode Microplate Readers 5 Ordering information VWR cat. Molecular Devices SpectraMax 340PC Microplate Spectrophotometer. 0200-6263. Expanded dynamic range Engineered for performance with spectral fusion illumination for increased sensitivity across the entire excitation range. SpectraMax®Plus384 SpectraMax®190 SpectraMax®340PC384. Microplate Readers. For the reference reading, use the “0” standard. The optical systems use two scanning monochromators soSpectramax Plus 384 Microplate Reader is available from The Lab World Group. Theseinstrumentsmeasuretheopticaldensity(OD)ofsamplesatselectedwavelengthsina singlereadmode. Or, with the reader specifications noted from the Instrument Description section of your reader's manual, as well as those for your PC, you can calculate needs more closely. 2) All labor charges to repair the product for a period of one (1) year from the original date of delivery will be paid by Molecular Devices Corporation. both cuvette-based and microplate reader applications on the same instrument. the SpectraMax iD3 is a fantastic plate reader for a wide range of assays. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SPECTRAmax GEMINI XS. Fixed a problem in SpectraMax Gemini setup when switching to luminescence where range checking errors were reported incorrectly. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a variety of assays. Catalog Number. SPECTRAmax PLUS 384 measuring instruments pdf manual download. Computer and software not available. SpectraMax® iD3, iD5, ABS, and ABS Plus readers, and up to 2. Service parts for these models are not being produced and are no longer in stock. With three modes of detection for full spectrum absorbance, fluorescence and luminescence, It is user upgradeable from 2 to 3 modes. Fluorescence Microplate Reader Comparison Chart. SpectraMax® M2 Multi-Mode Microplate Reader MLDVM2 SpectraMax® M2e Multi-Mode Microplate Reader (top and bottom reading) MLDVM2E SpectraMax® M3 Multi-Mode Microplate Reader MLDVM3 Ordering information VWR cat. The 1/absorptivity value for double stranded DNA at 260 nm is commonly assumed. It measures the optical density (OD) of samples in both 96- and 384-well. Ensure there are three inches between the back of the instrument and any other objects or surfaces so it has proper air flow. microplates or in a cuvette at a. With optimized reagents, option to operate the readers. Manufacturer: Molecular Devices Model: SpectraMax Will included PC workstation w/ preloaded softmax pro software Wavelength Range: 340 – 850 nm Wavelength Selection: Monochromator, tunable 1. 0 nm increments Wavelength Bandwidth: 2 nm Wavelength Accuracy: < ± 2. 1. TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate spectrophotometersproviderapidandsensitivemeasurementsofavarietyofanalytesacross awiderangeofconcentrations. The SPECTRAmax™ 340PC 384 microplate spectrophotometer provides rapid and sensitive measurements of a variety of analytes across a wide range of concentrations. SpectraMax® M2 and M2e Microplate Readers are the standard for UV/visible multimode reader absorbance, providing ultrafast and full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well microplates. Page 12 Chapter 1 SpectraMax GEMINI EM Operator’s Manual. These robust readers have been placed in labs from Antarctica to the. Optimized for 96- and 384-well plates, the Multi-Mode Detection Cartridge provides a broad array of measurement capabilities: Fluorescence Intensity (FI), Time. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. The top- and bottom-reading Gemini EM Microplate Reader with dual monochromators lets users determine the optimal excitation and emission settings for creative new fluorescence. Industry-leading SoftMax® Pro Microplate Data Acquisition and Analysis Software eliminates the need to export dataThe SpectraMax ABS Plus, can accommodate standard 96-well plates and 384-well plates. Three low volume 24-well bottom slides. 1. Act quickly! These items have limited quantity and availability. These instruments measure the optical density (OD) of samples at selected wavelengths in a single read mode. The microplates were read the next day from the bottom and the top in SpectraMax M5 and Gemini EM readers. Detection modalities include absorbance (UV-Vis Abs) and fluorescence intensity (FI) and have optical performance comparable to a top-of-the-line dedicated spectrofluorometer or. This integrated system. Tb donor/red acceptor. The SpectraMax ® Plus 384 Microplate Reader gives you walk-up convenience for both standard spectrophotometer and microplate reader applications on. Insert the snorkel into the bottle and then insert the snorkel into the snorkel clamp. Future ready The SpectraMax® i3x Multi-Mode microplate reader measures spectral-based Absorbance, Fluorescence, and Luminescence with the added functionality of modular. The SpectraMax® iD3 Multi-Mode Microplate Reader is the cornerstone of a complete laboratory solution designed to expand the boundaries of research capabilities. For fluorescence intensity assays, the SpectraMax® M2 and M2e units feature an. 0 nm increments. These VWR® Plus Series stainless steel refrigerators feature a multi-functional design for laboratory use. spectraMax 340pc 384 Microplate reader. SpectraMax Spectrophotometers for UV-Vis Absorbance Detection. The SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. Theseinstrumentsmeasuretheopticaldensity(OD)ofsamplesatselected wavelengthsinasinglereadmode. spr SpectraMax M2 M2e M3 M4 M5 M5e SpectraTest ABS2 v1. 00 USD BMG FLUOstar Omega Microplate Reader Unit2 - AV $10,295. The SpectraMax Plus 384 Microplate Reader for absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. Set up SoftMax Pro Software to use PathCheck as detailed above. 6. together with SpectraMax, VersaMax, VMax, and EMax microplate readers from Molecular Devices, offer a quality assurance screening solution for the detection of melamine contamination in such food products as milk, infant formula, pet food, and confectionery. Description: The SpectraMax® iD5 Multi-Mode Microplate Reader is the complete laboratory solution to help you increase your research. , FI 15 sec. 190-1000 nm. SPECTRAmax® PLUS384 is the only spectrophotometer with a built-in cuvette port and microplate drawer. 100 fmol 384-well (75 µL) 0. Supplier: Molecular Devices. 0 OD for earlier models. Every step is optimized for data acquired from a Molecular Devices microplate reader or data imported from. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. Stand alone mode is not available for the VersaMax. Made from polypropylene with conical well profiles to maximize recovery and allow working with sample volumes as low as 5 µl. Using the patented PathCheck® Pathlength Measurement Technology, the SpectraMax M4 Microplate Reader transforms each well in a microplate to a fixed. The low profile increases robotic stack capacity and storage. The PathCheck Sensor is a revolutionary new awardwinning1 technology in SpectraMax® Instruments for measuring the fluid level in every well of a microplate 2–5. The SpectraMax M4 Microplate Reader is the standard for UV/visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes, 96 and 384-well microplates. SoftMax Pro. Shaker time 0 to 999 seconds Temperature control Ambient. Manufacturer: Molecular Devices; Model: SpectraMax; Will included PC workstation w/ preloaded softmax pro software Wavelength Range: 340 – 850 nm Wavelength Selection: Monochromator, tunable 1. Detection modalities include absorbance (UV-Vis. Pick the best speed, sensitivity, and price for your needs. Data can be analyzed and combined from different plates. The SpectraMax® M Series Multi-Mode Microplate Readers measure UV and visible absorbance, fluorescence, luminescence, fluorescence polarization, TRF and HTRF. SPECTRAmax PLUS Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific pro-teins, nucleic acids, and other molecules across a wide range of concentrations. The SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. The optical performance is comparable to a top-of-the-line dedicated Unparalleled performance on a personalized platform. Page 13: Introduction Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SpectraMax GEMINI EM. It is an innovative way of normalizing the absorbance reading in a microplate well to that of a 1-cm cuvette. The value for 1000 should be higher than the value for 900. to View Figures. The SpectraMax 384 Plus lets you get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. Alpha 384 STD 96- and 384-well . The SpectraMax M5e Multi-Mode Microplate Reader features a triple-mode cuvette port, temperature control, microplate shaking, and the industry leading SoftMax Pro. This product is no longer available on Biocompare. Reference diodes enable elimination of measurement noise due to slight fluctuations in. Detection modalities are shown in Table 1-1. SpectraMax ® Plus 384 optics. 0112-0115J 9 Chapter1:Introduction TheSpectraMax®M3Multi-ModeMicroplateReader,SpectraMax®M4Multi-ModeMicroplate Reader,SpectraMax®M5Multi-ModeMicroplateReader,andSpectraMax®M5eMulti-Mode Molecular Devices SpectraMax Plus 384. Published Dec 16, 2020 | Updated Dec 16, 2020.